Not Sure Which Protocol Is Right for You?

Take our 3-minute quiz and get a personalized peptide protocol with exact dosages and cycling — tailored to your goals and body.

✓ Free ✓ Private ✓ Science-backed
Start the Quiz →

LL-37

Cathelicidin humano — péptido antimicrobiano de amplio espectro

4.5
2 reseñas
Rate This Peptide

Rating Breakdown

Antimicrobial Activity
5.0
Anti-Biofilm Activity
4.5
Immune Modulation
4.0
Antiviral Defense
4.0
Wound Healing Support
4.0
T-Cell Enhancement
3.5
Safety & Side Effects
3.0

Resumen

LL-37 es el único péptido antimicrobiano catelicidina humano, que proporciona una defensa de amplio espectro contra bacterias, virus y hongos.

Key Information

Identity
Also Known As Cathelicidin; hCAP-18
Sequence [LL-37, 37 aa]
CAS Number 154939-17-0
Molecular Formula C206H337N65O52
Properties
Half-Life Short (minutes)
Administration topical, subcutaneous
Dosage Range Varies by application
Price Range $1.5–$15.0/mg
Handling & Storage
Storage Lyophilized: -20C; Reconstituted: 2-8C
Reconstitution Reconstitute with bacteriostatic water
Regulatory Status
US Status Research only
Research Papers 5 indexed

Mecanismo

Perturba las membranas microbianas y modula el sistema inmunitario. Efectos antimicrobianos directos + inmunomoduladores.

Benefits

  • Antimicrobiano de amplio espectro
  • Actividad antibiofilm
  • Modulación inmune
  • Apoyo a la cicatrización de heridas

Side Effects

  • Posibilidad de resistencia a dosis subterapéuticas
  • Irritación a concentraciones elevadas

Contraindications

  • None established

Evidence Summary

Los estudios demuestran eficacia contra bacterias, biopelículas y modulación inmune.

Research

Los estudios demuestran eficacia contra infecciones bacterianas, biopelículas, y como inmunomodulador en infecciones crónicas.

Ver Investigación

Safety

Generalmente bien tolerado. Posibilidad de resistencia a dosis subterapéuticas.

Frequently Asked Questions About LL-37

What is LL-37?

LL-37 is a research peptide also known as Cathelicidin; hCAP-18. Cathelicidin humano — péptido antimicrobiano de amplio espectro It is studied for its potential therapeutic applications and is available from various research chemical vendors.

How does LL-37 work?

Perturba las membranas microbianas y modula el sistema inmunitario. Efectos antimicrobianos directos + inmunomoduladores.

What is the recommended dosage for LL-37?

The commonly studied dosage range for LL-37 is Varies by application. Dosage protocols vary based on research objectives. Always consult published studies and start with conservative amounts. LL-37 should only be used in controlled research settings.

Where can I buy LL-37?

PepsReview indexes LL-37 pricing from multiple vendors. Check the Vendors tab above for a price comparison table showing cost per milligram, purity, COA status, and stock availability. Vendor reviews from real users are available on each vendor's profile page.

Is LL-37 legal?

US regulatory status: Research only. The legal status of LL-37 varies by jurisdiction. In most countries, it is sold as a research chemical, not for human consumption. Always verify the legal status in your country before purchasing.

What are the side effects of LL-37?

Reported side effects include: Posibilidad de resistencia a dosis subterapéuticas, Irritación a concentraciones elevadas. Always review safety data and published studies before use.

Key Research Papers on LL-37

The following peer-reviewed studies and clinical trials are indexed in our research library for LL-37. Each paper links to a detailed summary with key findings, study design, and publication metadata.

No vendor prices yet

We don't have pricing data for this peptide yet.

Investigación

5 artículos de investigación indexados

Ver Investigación

Write a Review

Rating Breakdown

Effectiveness
5.0
Overall
4.5
Value
4.0
Safety
3.0

Based on 2 reseñas.

Reseñas

Cleared my chronic infection 2026-06-15
Tom V. Top Reviewer

LL-37 cleared a chronic bacterial infection that antibiotics couldn't touch. The broad-spectrum antimicrobial activity is impressive. Anti-biofilm properties make it effective against resistant bacteria. Wound healing also accelerated.

Eficacia: 5/5 Seguridad: 3/5 Valor: 4/5
Powerful antimicrobial peptide 2026-05-04
Tom V. Top Reviewer

LL-37 is a remarkable immune weapon. Fought off a stubborn sinus infection in days. The antimicrobial and antiviral defense is broad-spectrum. Be careful with dosing - too much can cause inflammation.

Eficacia: 5/5 Seguridad: 3/5 Valor: 4/5