Not Sure Which Protocol Is Right for You?

Take our 3-minute quiz and get a personalized peptide protocol with exact dosages and cycling — tailored to your goals and body.

✓ Free ✓ Private ✓ Science-backed
Start the Quiz →

LL-37

Human cathelicidin — broad-spectrum antimicrobial peptide

4.5
2 reviews
Rate This Peptide

Rating Breakdown

Antimicrobial Activity
5.0
Anti-Biofilm Activity
4.5
Immune Modulation
4.0
Antiviral Defense
4.0
Wound Healing Support
4.0
T-Cell Enhancement
3.5
Safety & Side Effects
3.0

Overview

LL-37 is the only human cathelicidin antimicrobial peptide, providing broad-spectrum defense against bacteria, viruses, and fungi.

Key Information

Identity
Also Known As Cathelicidin; hCAP-18
Sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
CAS Number 154939-17-0
Molecular Formula C206H337N65O52
Properties
Half-Life Short (minutes)
Administration topical, subcutaneous
Dosage Range Varies by application
Price Range $1.5–$15.0/mg
Handling & Storage
Storage Lyophilized: -20C; Reconstituted: 2-8C
Reconstitution Reconstitute with bacteriostatic water
Regulatory Status
US Status Research only
Research Papers 5 indexed

Mechanism

Disrupts microbial membranes and modulates the immune system. Direct antimicrobial + immunomodulatory effects.

Benefits

  • Broad-spectrum antimicrobial
  • Anti-biofilm activity
  • Immune modulation
  • Wound healing support

Side Effects

  • Potential for resistance at sub-therapeutic doses
  • Irritation at high concentrations

Contraindications

  • None established

Evidence Summary

Studies show efficacy against bacteria, biofilms, and immune modulation.

Research

Studies show efficacy against bacterial infections, biofilms, and as an immune modulator in chronic infections.

View Research

Safety

Generally well-tolerated. Potential for resistance at sub-therapeutic doses.

Frequently Asked Questions About LL-37

What is LL-37?

LL-37 is a research peptide also known as Cathelicidin; hCAP-18. Human cathelicidin — broad-spectrum antimicrobial peptide It is studied for its potential therapeutic applications and is available from various research chemical vendors.

How does LL-37 work?

Disrupts microbial membranes and modulates the immune system. Direct antimicrobial + immunomodulatory effects.

What is the recommended dosage for LL-37?

The commonly studied dosage range for LL-37 is Varies by application. Dosage protocols vary based on research objectives. Always consult published studies and start with conservative amounts. LL-37 should only be used in controlled research settings.

Where can I buy LL-37?

PepsReview indexes LL-37 pricing from multiple vendors. Check the Vendors tab above for a price comparison table showing cost per milligram, purity, COA status, and stock availability. Vendor reviews from real users are available on each vendor's profile page.

Is LL-37 legal?

US regulatory status: Research only. The legal status of LL-37 varies by jurisdiction. In most countries, it is sold as a research chemical, not for human consumption. Always verify the legal status in your country before purchasing.

What are the side effects of LL-37?

Reported side effects include: Potential for resistance at sub-therapeutic doses, Irritation at high concentrations. Always review safety data and published studies before use.

Key Research Papers on LL-37

The following peer-reviewed studies and clinical trials are indexed in our research library for LL-37. Each paper links to a detailed summary with key findings, study design, and publication metadata.

No vendor prices yet

We don't have pricing data for this peptide yet.

Research

5 research papers indexed

View Research

Write a Review

Rating Breakdown

Effectiveness
5.0
Overall
4.5
Value
4.0
Safety
3.0

Based on 2 reviews.

Reviews

Cleared my chronic infection 2026-06-15
Tom V. Top Reviewer

LL-37 cleared a chronic bacterial infection that antibiotics couldn't touch. The broad-spectrum antimicrobial activity is impressive. Anti-biofilm properties make it effective against resistant bacteria. Wound healing also accelerated.

Effectiveness: 5/5 Safety: 3/5 Value: 4/5
Powerful antimicrobial peptide 2026-05-04
Tom V. Top Reviewer

LL-37 is a remarkable immune weapon. Fought off a stubborn sinus infection in days. The antimicrobial and antiviral defense is broad-spectrum. Be careful with dosing - too much can cause inflammation.

Effectiveness: 5/5 Safety: 3/5 Value: 4/5